C - Chemistry – Metallurgy – 07 – K
Patent
C - Chemistry, Metallurgy
07
K
C07K 16/18 (2006.01) A61K 39/395 (2006.01) A61P 15/06 (2006.01) A61P 35/00 (2006.01) A61P 35/02 (2006.01) C07K 14/47 (2006.01) A61K 38/00 (2006.01)
Patent
CA 2177179
A method of suppressiom of cellular growth or enhancing immunological activity including the administration of cpn10 antag- onists or anti-cpn10 antidoby to a subject. There is also provided antagonists to or antibody raised against cpn10 or a recom- binant cpn10 which has the amino acid sequence GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGS- GSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD. There is also provided an assay for measuring anti- cpn10 antidoby in a sample including the steps of 1) reacting substantially purified cpn10 with the sample; and 2) determination of the amount of anti-cpn10 antibody in the sample by determining the binding between the antibody and cpn10.
L'invention concerne une méthode pour inhiber la croissance cellulaire ou pour augmenter l'activité immunologique, faisant appel à l'administration au sujet d'antagonistes à la chaperonine 10 (cpn10) ou d'anticorps anti-cpn10. On fournit également des antagonistes ou des anticorps contre la cpn10, ou une cpn10 de recombinaison qui a la séquence des acides aminés GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD. On fournit également une méthode pour doser l'anticorps anti-cpn10 dans un échantillon comprenant les étapes consistant 1) à faire réagir de la cpn10 sensiblement purifiée avec l'échantillon; et 2) à déterminer la quantité d'anticorps anti-cpn10 dans l'échantillon, en mesurant la liaison entre l'anticorps et la cpn10.
Cavanagh Alice Christina
Morton Halle
Fetherstonhaugh & Co.
The University Of Queensland
LandOfFree
Antagonists to chaperonin 10 does not yet have a rating. At this time, there are no reviews or comments for this patent.
If you have personal experience with Antagonists to chaperonin 10, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Antagonists to chaperonin 10 will most certainly appreciate the feedback.
Profile ID: LFCA-PAI-O-1803422