C - Chemistry – Metallurgy – 12 – N
Patent
C - Chemistry, Metallurgy
12
N
C12N 15/12 (2006.01) A01K 67/027 (2006.01) A61K 39/00 (2006.01) C07K 14/47 (2006.01) C12Q 1/00 (2006.01) A61K 38/00 (2006.01)
Patent
CA 2251584
The present invention relates to the use of autoantigen HC gp-39, and proteins comprising an amino acid sequence which exhibits at least 50 % homology with the amino acid sequence of HC gp-39, more particular with the amino acid sequence YKLVCYYTSWSQYREGDGSCFPDALDR-FLCTHIIYSFANISND (SEQ ID NO:1) in antigen-specific treatment of articular cartilage destruction in autoimmune diseases in mammals to induce systemic tolerance of the immune system. The autoantigen HC gp-39, and the arthritogenic proteins comprising an amino acid sequence which exhibits at least 50 % homology with the amino acid sequence YKLVCYYTSWSQYREGDGSCFPDALDR-FLCTHIIYSFANISND (SEQ ID NO:1) are also suitable to induce arthritis in animals, preferably mice. The invention furthermore relates to pharmaceutical compositions comprising said autoantigen and/or said arthritogenic proteins, a diagnostic method for the detection of autoreactive T cells in a test sample and test kits to be used in said method.
La présente invention concerne l'utilisation de l'auto-antigène HC gp-39 et des protéines comprenant une séquence d'acides aminés qui présente une homologie d'au moins 50 % avec la séquence d'acides aminés de HC gp-39, et plus particulièrement avec la séquence YKLVCYYTSWSQYREGDGSCFPDALDR-FLCTHIIYSFANISND (SEQ ID NO:1), pour le traitement, spécifique de l'antigène, de la destruction du cartilage articulaire dans les maladies auto-immunes chez les mammifères afin d'induire une tolérance systémique du système immun. L'auto-antigène HC gp-39 et les protéines arthritogènes comprenant une séquence d'acides aminés qui présente une homologie d'au moins 50 % avec la séquence d'acides aminés YKLVCYYTSWSQYREGDGSCFPDALDR-FLCTHIIYSFANISND (NO ID SEQ: 1) sont également appropriés pour induire l'arthrite chez des animaux, de préférence les souris. L'invention se rapporte en outre à des compositions pharmaceutiques comprenant l'auto-antigène et/ou les protéines arthritogènes, à un procédé de diagnostic destiné à détecter les lymphocytes T autoréactifs dans un échantillon pour analyse et à des trousses de tests devant être utilisées dans ce procédé.
Boots Anna Maria Helena
Bos Ebo Sybren
Verheijden Gijsbertus Franciscus Maria
Akzo Nobel Nv
Fetherstonhaugh & Co.
LandOfFree
Autoantigen and proteins structurally related thereto for... does not yet have a rating. At this time, there are no reviews or comments for this patent.
If you have personal experience with Autoantigen and proteins structurally related thereto for..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Autoantigen and proteins structurally related thereto for... will most certainly appreciate the feedback.
Profile ID: LFCA-PAI-O-2069245