C - Chemistry – Metallurgy – 07 – K
Patent
C - Chemistry, Metallurgy
07
K
C07K 14/47 (2006.01) C12N 15/62 (2006.01) G01N 33/50 (2006.01)
Patent
CA 2554822
The invention concerns a peptide molecule capable of interfering with the HLH domain of TAL-1, consisting of or comprising at least 10 successive amino acids and preferably at least 15 successive amino acids of the HLH domain of TAL-1 of sequence: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA corresponding to SEQ ID No. 1 whereof the listing of sequences is annexed or an equivalent sequence, said molecule being advantageously associated with a vector. The invention also concerns a pharmaceutical composition containing said peptide molecule and the use of a compound capable of interacting with the HLH domain of TAL-1 for preparing a medicine designed for the prevention and/or treatment of diseases related to angiogenensis, preferably the treatment of cancers, arteriosclerosis and diabetes. The invention further concerns a method for identifying a biologically active compound capable of being used in the prevention and/or treatment of diseases related to angiogenensis, preferably the treatment of cancers treatment of cancers, arteriosclerosis and diabetes which consists in detecting inhibition of the interaction between the HLH domain of TAL-1 and its partner E47 in the presence of said compound.
La présente invention concerne une molécule peptidique capable d~interférer avec le domaine HLH de TAL-1, constituée par ou comprenant au moins 10 acides aminés successifs et, de préférence, au moins 15 acides aminés successifs du domaine HLH de TAL-1 de séquence : QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA correspondant à la SEQ ID No. 1 dans le listage de séquences en annexe ou une séquence équivalente, ladite molécule étant avantageusement associée à un vecteur. La présente invention concerne également une composition pharmaceutique contenant ladite molécule peptidique et l~utilisation d~un composé capable d~interagir avec le domaine HLH de TAL-1 pour la préparation d~un médicament destiné à la prévention et/ou au traitement des maladies liées à l~angiogenèse et, de préférence, au traitement des cancers, de l~artériosclérose et du diabète. Enfin, la présente invention concerne également un procédé pour identifier un composé biologiquement actif susceptible d~être utilisé dans la prévention et/ou le traitement des maladies liées à l~angiogenèse et, de préférence, le traitement des cancers, de l~artériosclérose et du diabète consistant à détecter l~inhibition de l~interaction entre le domaine HLH de TAL-1 et son partenaire E47 en présence dudit composé.
Kaczorek Michel
Mathieu Daniele
Temsamani Jamal
Smart & Biggar
Synt:em
LandOfFree
Angiogenesis inhibitors, compositions containing same and... does not yet have a rating. At this time, there are no reviews or comments for this patent.
If you have personal experience with Angiogenesis inhibitors, compositions containing same and..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Angiogenesis inhibitors, compositions containing same and... will most certainly appreciate the feedback.
Profile ID: LFCA-PAI-O-1357057