Biologically active tgf-.beta.1 and tgf-.beta.2 peptides

C - Chemistry – Metallurgy – 07 – K

Patent

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

C07K 14/495 (2006.01) A61K 38/18 (2006.01) A61K 38/00 (2006.01)

Patent

CA 2153789

The invention relates to peptides corresponding to regions of the amino acid sequence of TGF-.beta.1 or TGF-.beta.2 which retain, either in monomeric or polymeric forms, at least some of the biological activity of the respective full length TGF-.beta.. The monomeric form of the peptide derived from TGF-.beta.1 comprises the following amino acid sequence: CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGP. The monomeric form of the peptide derived from TGF-.beta.2 comprises the following amino acid sequence: CLRPLYIDFKRDLGWKWIHEPKGYNANFCAGA. Dimers may be formed via disulfide bonds between the amino-terminal cysteine residues, the carboxy-terminal cysteine residues, or amino- and carboxy-terminal cysteine residues of the monomer subunits.

LandOfFree

Say what you really think

Search LandOfFree.com for Canadian inventors and patents. Rate them and share your experience with other people.

Rating

Biologically active tgf-.beta.1 and tgf-.beta.2 peptides does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Biologically active tgf-.beta.1 and tgf-.beta.2 peptides, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Biologically active tgf-.beta.1 and tgf-.beta.2 peptides will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFCA-PAI-O-1670180

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.