Biologically active tgf-.beta.1 and tgf-.beta.2 peptides

Details Biologically active tgf-.beta.1 and tgf-.beta.2 peptides Biologically active tgf-.beta.1 and tgf-.beta.2 peptides

C - Chemistry, Metallurgy

07

K

C07K 14/495 (2006.01) A61K 38/18 (2006.01) A61K 38/00 (2006.01)

Patent

CA 2153789

The invention relates to peptides corresponding to regions of the amino acid sequence of TGF-.beta.1 or TGF-.beta.2 which retain, either in monomeric or polymeric forms, at least some of the biological activity of the respective full length TGF-.beta.. The monomeric form of the peptide derived from TGF-.beta.1 comprises the following amino acid sequence: CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGP. The monomeric form of the peptide derived from TGF-.beta.2 comprises the following amino acid sequence: CLRPLYIDFKRDLGWKWIHEPKGYNANFCAGA. Dimers may be formed via disulfide bonds between the amino-terminal cysteine residues, the carboxy-terminal cysteine residues, or amino- and carboxy-terminal cysteine residues of the monomer subunits.

Affiliated with

Also associated with

Rating

Biologically active tgf-.beta.1 and tgf-.beta.2 peptides does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Biologically active tgf-.beta.1 and tgf-.beta.2 peptides, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Biologically active tgf-.beta.1 and tgf-.beta.2 peptides will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFCA-PAI-O-1670180