Bovine milk growth factor

Details Bovine milk growth factor Bovine milk growth factor

C - Chemistry, Metallurgy

12

N

C12N 15/10 (2006.01) A61K 38/18 (2006.01) C07K 1/14 (2006.01) C07K 1/36 (2006.01) C07K 14/475 (2006.01) C12N 15/18 (2006.01) C12N 15/63 (2006.01)

Patent

CA 2309317

A mammalian milk growth factor (MMGF) having the following amino acid sequence or substantially homologous sequence: DGNSTRSPEDDGLLCGDHAENCPATTTQPKRRGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYAGARCERVDLF Y or a mutant, analogue, derivative or functionally active fragment thereof.

L'invention concerne un facteur de croissance du lait de mammifère (MMGF: mammalian milk growth factor) présentant la séquence d'acides aminés suivante ou une séquence sensiblement homologue: DGNSTRSPEDDGLLCGDHAENCPATTTQPKRRGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYAGARCERVDLFY, ou un mutant, un analogue, un dérivé ou un fragment présentant une activité fonctionnelle de ce dernier.

Affiliated with

Also associated with

Rating

Bovine milk growth factor does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Bovine milk growth factor, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Bovine milk growth factor will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFCA-PAI-O-1604313