Cancer cell-produced polypeptides and their production and use

Details Cancer cell-produced polypeptides and their production and use Cancer cell-produced polypeptides and their production and use

C - Chemistry, Metallurgy

07

K

150/9, 195/128.1

C07K 14/47 (2006.01) A61K 38/17 (2006.01) A61K 39/00 (2006.01) C07K 14/475 (2006.01) C07K 14/82 (2006.01) G01N 33/574 (2006.01)

Patent

CA 1340711

Disclosed is a novel polypeptide whose N-terminus is EAQ and which is composed of 60 amino acids. The polypeptide is produced from human breast cancer cell MCF7, or human gastric cancer cell MKN-95 or KATO-III, which polypeptide has a isoelectric point of 4.3, a molecular weight of 6,661 and the following amino acid sequence: EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPP EEECEF The polypeptide may be used for diagnosis of cancer or as a therapeutic agent for carcinoma.

609543

Affiliated with

Also associated with

Rating

Cancer cell-produced polypeptides and their production and use does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Cancer cell-produced polypeptides and their production and use, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Cancer cell-produced polypeptides and their production and use will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFCA-PAI-O-1174565