C - Chemistry – Metallurgy – 07 – K
Patent
C - Chemistry, Metallurgy
07
K
C07K 14/47 (2006.01) A61K 38/06 (2006.01) A61K 38/08 (2006.01) A61K 38/10 (2006.01) A61K 38/17 (2006.01) A61K 38/18 (2006.01) A61P 17/02 (2006.01) A61P 29/00 (2006.01) A61P 37/06 (2006.01) A61P 37/08 (2006.01) C07K 7/04 (2006.01) C07K 7/06 (2006.01) C07K 16/18 (2006.01) G01N 33/53 (2006.01) A61K 38/00 (2006.01)
Patent
CA 2176948
A process for the detection of cpn10 in serum or other biological fluids including the steps of (i) raising antibody to cpn10; (ii) reacting said antibody with a sample of biological fluid suspected of containing cpn10; and (iii) detecting the presence of cpn10 in said sample by a signal amplification resulting from production of a cpn10-antibody complex. There is also provided a process for promotion of cell growth or immunosuppression including the step of administration of cpn10 to a mammalian subject. There is also provided recombinant cpn10 having the sequence GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGS- GSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD.
L'invention concerne un procédé de détection de la chaperonine 10 (cpn10) dans le sérum ou dans d'autres fluides biologiques, comprenant les étapes consistant à (i) produire un anticorps contre la cpn10; (ii) à faire réagir ledit anticorps avec un échantillon de fluide biologique susceptible de contenir de la cpn10; et (iii) à détecter la présence de cpn10 dans ledit échantillon par une amplification du signal résultant de la production d'un complexe cpn10-anticorps. On fournit également un procédé pour favoriser la croissance cellulaire ou une immunosuppression, consistant à administrer de la cpn10 à un mammifère. On fournit également une cpn10 de recombinaison ayant la séquence GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD.
Cavanagh Alice Christina
Morton Halle
Fetherstonhaugh & Co.
The University Of Queensland
LandOfFree
Chaperonin 10 does not yet have a rating. At this time, there are no reviews or comments for this patent.
If you have personal experience with Chaperonin 10, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Chaperonin 10 will most certainly appreciate the feedback.
Profile ID: LFCA-PAI-O-1394668