Conformational epitopes of human immunodeficiency virus...

Details Conformational epitopes of human immunodeficiency virus... Conformational epitopes of human immunodeficiency virus...

C - Chemistry, Metallurgy

12

N

167/130, 167/139

C12N 15/48 (2006.01) A61K 39/00 (2006.01) A61K 39/21 (2006.01) C07K 14/16 (2006.01) C12N 15/49 (2006.01)

Patent

CA 2035576

ABSTRACT OF THE DISCLOSURE The present invention concerns a portion of a conformational epitope of human immunodeficiency virus envelope gp120 comprising the sequence EDIISLWDQSLKPCVKLTPLCVSLKCTDLK 113 142 of the BH-10 subtype, not comprising more than 302 amino acids, and analogous sequences from human immunodeficiency virus gp120 isolates other than BH-10. Such sequence can be employed in an anti-HIV-1 vaccine. The sequence can also be used in combination with amino acid sequences from (303-338) of the BH subtype of HIV-1, or analogous sequences from HIV-1 isolates other than BH-10.

Affiliated with

Also associated with

Rating

Conformational epitopes of human immunodeficiency virus... does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Conformational epitopes of human immunodeficiency virus..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Conformational epitopes of human immunodeficiency virus... will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFCA-PAI-O-1995835