Fragments of cr1 and their use

Details Fragments of cr1 and their use Fragments of cr1 and their use

C - Chemistry, Metallurgy

12

N

C12N 15/12 (2006.01) A61K 38/08 (2006.01) A61K 38/10 (2006.01) A61K 38/17 (2006.01) A61K 47/48 (2006.01) A61P 29/00 (2006.01) C07K 7/06 (2006.01) C07K 7/08 (2006.01) C07K 14/705 (2006.01) C07K 19/00 (2006.01) C12N 15/62 (2006.01)

Patent

CA 2247998

A polypeptide comprising a portion of the sequence of the general formula (I): CNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSG, of 6 to 23 amino acids in length and comprising sequence a) and/or b): a) GGRKVF, b) FELVGEPSIY multimeric and chimaeric derivatives, pharmaceutical compositions containing them and their use in therapy.

L'invention concerne un polypeptide comprenant une portion d'une séquence de la formule générale (I): CNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSG, ayant un enchaînement de 6 à 23 aminoacides comprenant la séquence (a) GGRKVF et/ou (b) FELVGEPSIY et les dérivés multimères et chimères de ces séquences, des compositions pharmaceutiques les contenant et leurs utilisations thérapeutiques.

Affiliated with

Also associated with

Rating

Fragments of cr1 and their use does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Fragments of cr1 and their use, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Fragments of cr1 and their use will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFCA-PAI-O-1397248