Human and mammalian dna replication origin consensus sequences

C - Chemistry – Metallurgy – 12 – N

Patent

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

C12N 15/85 (2006.01) C12N 15/11 (2006.01) C12N 15/90 (2006.01)

Patent

CA 2274306

The present invention relates to a human or mammalian DNA replication origin consensus sequence which consists of a sequence selected from the group consisting of CCTMDAWKSGBYTSMAAWYWBCMYTTRSCAAATTCC (SEQ ID NO:1); and AWMTWAAKRAWRWWKKDAVWWGAKRWWKWVWHRASSACMDWKAAKTWKGGWTWARRYWKGRKMWWTWKAWSDATAKWWW KDAKWKMWRKTT (SEQ ID NO:4). A method for the control of initiation of mammalian DNA replication which comprises the steps of: a) inserting a consensus sequence coding for a sequence of the present invention together with a DNA fragment to form a vector capable of expression of the DNA fragment; b) introducing the vector of step a) into mammalian cells in vitro.

L'invention concerne une séquence consensus de l'origine de réplication d'ADN humain ou d'ADN de mammifère, qui est constituée d'une séquence choisie dans le groupe comprenant CCTMDAWKSGBYTSMAAWYWBCMYTTRSCAAATTCC (SEQ ID NO:1) et AWMTWAAKRAWRWWKKDAVWWGAKRWWKWVWHRASSACMDWKAAKTWKGGWTWARRYWKGRKMWWTWKAWSDATAKWWWKDAKWKMWRKTT (SEQ ID NO:4). Elle concerne également une méthode permettant de contrôler l'initiation de la réplication de l'ADN d'un mammifère, selon laquelle: a) on insère une séquence consensus codant pour une séquence de la présente invention en même temps qu'un fragment d'ADN, de façon à former un vecteur capable d'exprimer ledit fragment; et b) on introduit le vecteur de l'étape a) dans des cellules de mammifère in vitro.

LandOfFree

Say what you really think

Search LandOfFree.com for Canadian inventors and patents. Rate them and share your experience with other people.

Rating

Human and mammalian dna replication origin consensus sequences does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Human and mammalian dna replication origin consensus sequences, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Human and mammalian dna replication origin consensus sequences will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFCA-PAI-O-2012396

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.