Human galanin, cdna clones encoding human galanin and a...

Details Human galanin, cdna clones encoding human galanin and a... Human galanin, cdna clones encoding human galanin and a...

C - Chemistry, Metallurgy

12

N

C12N 15/12 (2006.01) A61K 38/22 (2006.01) C07K 14/575 (2006.01) G01N 33/554 (2006.01) G01N 33/567 (2006.01) A61K 38/00 (2006.01)

Patent

CA 2105572

2105572 9215681 PCTABS00016 The present invention provides a peptide having the amino acid sequence of human galanin. The amino acid sequence of this peptide is: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS. The present invention further provides DNA clones encoding the peptide and to therapeutic uses of the peptide.

Affiliated with

Also associated with

Rating

Human galanin, cdna clones encoding human galanin and a... does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Human galanin, cdna clones encoding human galanin and a..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Human galanin, cdna clones encoding human galanin and a... will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFCA-PAI-O-1451383