Immunologically active proteins from borrelia burgdorferi,...

C - Chemistry – Metallurgy – 12 – N

Patent

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

C12N 15/31 (2006.01) A61K 31/70 (2006.01) A61K 39/02 (2006.01) A61K 48/00 (2006.01) C07K 14/20 (2006.01) C12Q 1/68 (2006.01) G01N 33/569 (2006.01) A61K 39/00 (2006.01)

Patent

CA 2263152

The invention relates to immunologically active proteins of Borrelia burgdorferi, which are available in a free form of other Borrelia burgdorferi derived proteins, with a protein 1829-22A sequence, which has the amino acid sequence MKKFNLIIEALFAILLTACNFGLMEETKIALESSSKDVKNKILQIKKDAEDKGVN- FAAFTSSETGSKVTNGGLALREAKIQAINEVEKFLKRIEEEALKLKEHGNSGQFLELFDLLLEVLESLEPIGIKGL KDFISEEAKCNPISTSERLIEVKVQIENKMEEVKRKQNLNKERKSNKGKKKK or a partial sequence thereof with at least 10 consecutive amino acids or with the protein 1829-22B sequence, which has the amino acid sequence MIKYNKIILTLTLLASLLAACSLTGKAR- LESSVKDITNEIEKAIKEAEDAGVKTDAFTETQTGGKVAGPKIRAAKIRVADLTIKFLEATEEETITFKENGAGEDEFS GIYDLIL NAAKAVEKIGMKDMTKTVEEAAKENPKTTANGIIEIVKVMKAKVENIKEKQTKNQK or a partial sequence thereof, with at least 10 consecutive amino acids.

L'invention concerne des protéines de borrelia burgdorferi immunologiquement actives, dérivés sous forme libre d'autres protéines de borrelia burgdorferi, avec une séquence de la protéine 1829-22A, laquelle a la séquence aminoacide MKKNLIIEALFAILLTACNFGLMEETKIALESSSKDVKNKILQIKKDAEDKGVNFAAFTSSETGSKVTNGGLALREAKIQANEVEKFLKRIEEEALKLKEHGNSGQFLELFDLLLEVLESLEPIGIKGLKDFISEE AKCNPISTSERLIEVKVQIENKMEEVKRKQNLNKERKSNKGKKKK ou une partie de cette séquence, avec au moins 10 acides aminés consécutifs ou avec la séquence de la protéine 1829-22B, laquelle a la séquence aminoacide MIKYNKIILTLTLLASLLAACSLTGKARLESSVKDITNEIEKAKEAEDAGVKTDAFTETQTGGKVAGPKIRAAKIRVADLTIKFLEATEEETITFKENGAGEDEFSGIYDLILNAA KAVEKIGMKDMTKTVEEAAKENPKEEANGIIEIVKVMKAKVENIKEKQTKNQK ou une partie de cette séquence, avec au moins 10 acides aminés consécutifs.

LandOfFree

Say what you really think

Search LandOfFree.com for Canadian inventors and patents. Rate them and share your experience with other people.

Rating

Immunologically active proteins from borrelia burgdorferi,... does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Immunologically active proteins from borrelia burgdorferi,..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Immunologically active proteins from borrelia burgdorferi,... will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFCA-PAI-O-1717934

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.