Malarial binding site on duffy blood group protein

C - Chemistry – Metallurgy – 07 – K

Patent

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

C07K 14/445 (2006.01) A61K 39/015 (2006.01) C07K 14/715 (2006.01) A61K 38/00 (2006.01)

Patent

CA 2308833

A composition and method for inhibiting binding of malarial Duffy-binding ligand to Duffy blood group antigens on mammalian erythrocytes is disclosed. The composition includes a Duffy-related peptide which interferes with binding between Duffy antigen expressed on erythrocyte cell surfaces and the Duffy- binding ligands of merozoites. Particularly preferred peptides are the peptides having the sequences AELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYD (SEQ ID NO:1) or AELSPSTQNSSQLNSDLWNFSYDGNDSFPDVDYD (SEQ ID NO:4), as well as peptides which comprise either of those sequences in their primary structure, or other peptides having equivalent function. A method is disclosed which comprises administering a Duffy-based peptide which interferes with malarial binding to Duffy antigen in an amount sufficient to inhibit binding of merozoites to erythrocytes.

On décrit une composition et un procédé qui empêchent la liaison du ligand de liaison du système Duffy de la malaria à des antigènes du système Duffy sur des érythrocytes de mammifères. La composition comprend un peptide lié au système Duffy et qui perturbe la liaison entre l'antigène Duffy exprimé sur des surfaces cellulaires d'érythrocytes et les ligands de liaison du système Duffy de mérozoïtes. Les peptides plus particulièrement préférés sont les peptides à séquences AELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYD (SEQ ID NO:1) ou AELSPSTQNSSQLNSDLWNFSYDGNDSFPDVDYD (SEQ ID NO:4) ainsi que les peptides qui comprennent une de ces séquences dans leur structure primaire ou d'autres peptides ayant une fonction équivalente. On décrit un procédé qui consiste à administrer un peptide à base Duffy qui perturbe la liaison paludéenne avec un antigène Duffy, dans une qualité suffisante pour empêcher la liaison de mérozoïtes à des érythrocytes.

LandOfFree

Say what you really think

Search LandOfFree.com for Canadian inventors and patents. Rate them and share your experience with other people.

Rating

Malarial binding site on duffy blood group protein does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Malarial binding site on duffy blood group protein, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Malarial binding site on duffy blood group protein will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFCA-PAI-O-1508861

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.