C - Chemistry – Metallurgy – 07 – K
Patent
C - Chemistry, Metallurgy
07
K
C07K 14/245 (2006.01) A61K 39/108 (2006.01) A61K 39/385 (2006.01) C07K 16/12 (2006.01) C07K 19/00 (2006.01) A61K 39/00 (2006.01)
Patent
CA 2223013
A consensus peptide of 36 amino acids has been designed which acts as an immunogen raising antibodies against the proteins of all members of the E.coli family CS4-CFA/1. While the N-terminus of members of this family of organisms shows a high degree of identity, the remainder of the sequence of the proteins shows much less homology across the strains. The region of the protein represented in the subunit encompasses known linear B- and T-cell epitopes of CFA/I. The consensus peptide has a high level of homology to strains bearing six different colonization factors. The consensus peptide is of the formula: VEKNTTVTASVDPTIDLLQADGSALPSAVALTYSPA. An alternative peptide, identified as consensus peptide 2 is of the formula: VEKNITVTASVDPTIDLLQADGSALPASVALTYSPA.
Un peptide consensus à 36 acides aminés a été mis au point, lequel fait office d'immunogène dressant des anticorps contre les protéines de tous les membres de la famille CS4-CFA/1 des E. Coli. Tandis que l'extrémité N terminale des membres de cette famille d'organismes présente un degré d'identité élevé, le reste de la séquence des protéines présente une bien moindre homologie entre souches. La région de la protéine représentée dans la sous-unité englobe des épitopes de CFA/1 de lymphocytes linéaires connus B et T. Le peptide consensus présente un haut degré d'homologie avec les souches porteuses de six facteurs de colonisation différents. Il est de formule: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA. Un peptide alternatif, identifié comme peptide consensus 2, est de formule: VEKNITVTASVDPTIDLLQADGSALPASVALTYSPA.
Anderson Jeffrey
Carter John Mark
Cassels Frederick
Department Of The Army U.s. Government
Norton Rose Or S.e.n.c.r.l. S.r.l./llp
LandOfFree
Methods of raising antibodies against e.coli of the family... does not yet have a rating. At this time, there are no reviews or comments for this patent.
If you have personal experience with Methods of raising antibodies against e.coli of the family..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Methods of raising antibodies against e.coli of the family... will most certainly appreciate the feedback.
Profile ID: LFCA-PAI-O-1868241