Monoclonal antibodies for use in diagnosis and treatment of...

C - Chemistry – Metallurgy – 07 – K

Patent

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

C07K 16/30 (2006.01) A61K 39/395 (2006.01) A61K 47/48 (2006.01) A61K 49/00 (2006.01) C07K 19/00 (2006.01) G01N 33/574 (2006.01) G01N 33/577 (2006.01) A61K 38/00 (2006.01)

Patent

CA 2168440

A molecule which (i) binds human membrane-bound carcinoembryonic antigen, (ii) binds a hybrid polypeptide consisting of residues 1 to 314 of human biliary glycoprotein joined (N-C) to residues 490 to C-terminus of human carcino embryonic antigen, but (iii) does not bind to human biliary glycoprotein excluding an intact mouse monoclonal antibody comprising an IgG group IIA heavy chain and a kappa group V light chain wherein the sequence of the VH chain is QVKLQQSGPELKKPGETVKISCKASGYTFTVFGMNWVKQAPGKGLKWMGWIN- TKTGEATYVEEFKGRFAFSLETSATTAYLQINNLKNEDTAKYFCARWDFYDYVEAMDYWGQGTTVTVSS, or wherein the sequence of the VH chain is as given immediately above but the first amino acid residue of the VH CDR1 is glutamine and in either case the sequence of the VL chain is GDIVMTQSQRFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKALIYSASYRYSGVPDRFTGSG- SGTDFTLTISNVQSEDLAEYFCHQYYTYPLFTFGSGTKLEMKR. Preferably the molecule is a monoclonal antibody.

Une molécule qui (i) se lie à l'antigène carcino-embryonnaire membranaire humain, (ii) se lie à un polypeptide hybride composé des résidus 1 à 314 de glycoprotéines biliaires humaines liés (N-C) aux résidus 490 à la terminaison C de l'antigène carcino-embryonnaire humain, mais (iii) ne se lie pas à la glycoprotéine biliaire humaine, excluant un anticorps monoclonal de souris comprenant une chaîne lourde d'IgG du groupe IIA et une chaîne légère kappa du groupe V dans laquelle la séquence de la chaîne VH est QVKLQQSGPELKKPGETVKISCKASGYTFTVFGMNWVKQAPGKGLKWMGWINTKTGEATYVEEFKGRFAFSLETSATTAYLQINNLKNEDTAKYFCARWDFYDYVEAMDYWGQGTTVTVSS ou dans laquelle la séquence de la chaîne VH est celle qui est indiquée ci-dessus mais dans laquelle le premier résidu d'acide aminé de la CRD1 VH est la glutamine, et la séquence de la chaîne VL dans les deux cas est GDIVMTQSQRFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKALIYSASYRYSGVPDRFTGSG-SGTDFTLTISNVQSEDLAEYFCHQYYTYPLFTFGSGTKLEMKR. La molécule est de préférence un anticorps monoclonal.

LandOfFree

Say what you really think

Search LandOfFree.com for Canadian inventors and patents. Rate them and share your experience with other people.

Rating

Monoclonal antibodies for use in diagnosis and treatment of... does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Monoclonal antibodies for use in diagnosis and treatment of..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Monoclonal antibodies for use in diagnosis and treatment of... will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFCA-PAI-O-1512006

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.