Monoclonal antibody which agglutinates e. coli having the...

Details Monoclonal antibody which agglutinates e. coli having the... Monoclonal antibody which agglutinates e. coli having the...

C - Chemistry, Metallurgy

07

K

C07K 16/12 (2006.01) A61K 39/40 (2006.01) C12Q 1/10 (2006.01) G01N 33/569 (2006.01) A61K 38/00 (2006.01)

Patent

CA 2262819

A monoclonal antibody to a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA. The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.

Anticorps monoclonal d'un peptide consensus de la formule: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA. L'anticorps monoclonal de l'invention se fixe exclusivement à la séquence SAVALTYS. Il sert pour le diagnostic et la prophylaxie des maladies provoquées par E. Coli engendrant la famille de protéines CS4-CFA/I, et pour le traitement des maladies qui en sont issues.

Affiliated with

Also associated with

Rating

Monoclonal antibody which agglutinates e. coli having the... does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Monoclonal antibody which agglutinates e. coli having the..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Monoclonal antibody which agglutinates e. coli having the... will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFCA-PAI-O-1493139