Peptide sequences and compositions

Details Peptide sequences and compositions Peptide sequences and compositions

C - Chemistry, Metallurgy

07

K

C07K 14/11 (2006.01) A61K 39/145 (2006.01)

Patent

CA 2641602

Provided is a polypeptide having no' more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ ID 2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ ID 3 DLIFLARSALILRGSVAHKSC SEQ ID 4 PGIADIEDLTLLARSMWVRP SEQ ID 5 LLIDGTASLSPGMMMGMFNMLSTVLGVSrLNLGQ SEQ ID 6 HGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.

La présente invention concerne un polypeptide ne comprenant pas plus de 100 acides aminés. Ledit polypeptide se compose d'une ou plusieurs séquences présentant au moins 60 % d'homologie avec n'importe quelle SEQ ID 1-6, ou comprend au moins deux épitopes contenant au moins 7 acides aminés, chaque épitope présentant au moins 60 % d'homologie avec une sous-séquence de toute SEQ ID 1-6 possédant une longueur identique à celle de l'épitope : SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP ; SEQ ID 2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS ; SEQ ID 3 DLIFLARSALILRGSVAHKSC ; SEQ ID 4 PGIADIEDLTLLARSMWVRP ; SEQ ID 5 LLIDGTASLSPGMMMGMFNMLSTVLGVSrLNLGQ ; SEQ ID 6 HGILHLILWILDRLFFKCIYRLF. Le polypeptide est immunogène chez un vertébré, exprime un allèle de complexe majeur d'histocompatibilité (MHC) et ne constitue pas une protéine complète du virus de la grippe.

Affiliated with

Also associated with

Rating

Peptide sequences and compositions does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Peptide sequences and compositions, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Peptide sequences and compositions will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFCA-PAI-O-1555014