Peptides for the treatment of herpes virus infections

Details Peptides for the treatment of herpes virus infections Peptides for the treatment of herpes virus infections

A - Human Necessities

61

K

A61K 38/01 (2006.01) A61K 38/17 (2006.01) A61P 31/22 (2006.01)

Patent

CA 2558289

The present invention relates to the use of a peptide having the amino acid sequence NH2- VCVLAHHFGKEFTPPVQAAYQKWAGVANALAHKYH- COOH as well as variants, derivatives and fragments of the peptide for the treatment of viral diseases.

La présente invention concerne l'utilisation d'un peptide présentant la séquence d'acides aminés NH2- VCVLAHHFGKEFTPPVQAAYQKWAGVANALAHKYH- COOH ainsi que des variantes, dérivés et fragments dudit peptide dans le traitement de maladies virales.

Affiliated with

Also associated with

Rating

Peptides for the treatment of herpes virus infections does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Peptides for the treatment of herpes virus infections, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Peptides for the treatment of herpes virus infections will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFCA-PAI-O-1597755