Peptides of regulatory or accessory proteins of hiv,...

Details Peptides of regulatory or accessory proteins of hiv,... Peptides of regulatory or accessory proteins of hiv,...

C - Chemistry, Metallurgy

07

K

C07K 14/16 (2006.01) A61K 38/16 (2006.01) A61P 31/18 (2006.01)

Patent

CA 2645342

Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-4, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-4 that has the same length as the epitope: SEQ ID 1 GDTWAGVEAIIRILQQLLFIHFRIGCQHSR; SEQ ID 2 KVGSLQYLALTALITPKKIKPPLPSVKKLTEDRWNKPQKT; SEQ TD 3 EPVPLQLPPLERLTLDCSEDCGTSGTQ; SEQ ID 4 YKGALDLSHFLKEKGGLEGLIYSQKRQDILDLWVYHTQGYFPD wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete HIV virus protein.

La présente invention concerne un polypeptide comportant moins de 100 acides aminés et comprenant une ou plusieurs séquences d'homologie au moins égale à 60 % vis-à-vis de l'une quelconque des SEQ ID 1 à 4, ou comprenant deux épitopes ou plus comptant au moins 7 acides aminés, chacun des épitopes étant d'homologie au moins égale à 60 % vis-à-vis d'une sous-séquence de l'une quelconque des SEQ ID 1 à 4 de longueur identique à celle de l'épitope : SEQ ID 1 GDTWAGVEAIIRILQQLLFIHFRIGCQHSR; SEQ ID 2 KVGSLQYLALTALITPKKIKPPLPSVKKLTEDRWNKPQKT; SEQ ID 3 EPVPLQLPPLERLTLDCSEDCGTSGTQ; SEQ ID 4 YKGALDLSHFLKEKGGLEGLIYSQKRQDILDLWVYHTQGYFPD, le polypeptide étant immunogène chez un vertébré exprimant un allèle du complexe majeur d'histocompatibilité (CMH), le polypeptide n'étant pas une protéine virale de VIH entière.

Affiliated with

Also associated with

Rating

Peptides of regulatory or accessory proteins of hiv,... does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Peptides of regulatory or accessory proteins of hiv,..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Peptides of regulatory or accessory proteins of hiv,... will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFCA-PAI-O-1726795