Peptides responsive to antibodies against a consensus...

C - Chemistry – Metallurgy – 07 – K

Patent

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

C07K 14/245 (2006.01) A61K 39/108 (2006.01) A61K 39/40 (2006.01) C07K 7/06 (2006.01) C07K 7/08 (2006.01) C07K 16/12 (2006.01) C12N 1/00 (2006.01) G01N 33/569 (2006.01) A61K 38/00 (2006.01) A61K 39/00 (2006.01)

Patent

CA 2262893

This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (Seq. #1). Eight mer peptides from within the consensus peptide were tested against an antibody raised to the consensus peptide. Studies relating to antibody raised to denatured proteins from the natural organisms producing the family of proteins were also useful and showed particular value of some sequences. A sequence of the formula ASVDPTIDLLQA (Seq. #2) was identified thereby. An enlarge sequence of the formula TVTASVDPTIDLLQAD (Seq. #3) is also especially interesting as are intermediate sequences such as sequences VTASVDPTIDLLQAD (Seq. #4), TASVDPTIDLLQAD (Seq. #5), and TASVDPTIDLLQA (Seq. #6) as being binding sites for antibodies raised to the denatured proteins.

L'invention concerne des séquences d'acides aminés provenant d'un peptide consensus de la formule: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (Séq. #1). On a essayé huit peptides mer provenant du peptide consensus et dirigés contre un anticorps dirigé contre le peptide consensus. Des études relatives à un anticorps dirigé contre des protéines dénaturées, provenant d'organismes naturels produisant la famille de protéines, ont été également utiles et ont montré la valeur particulière de certaines séquences. On a identifié ainsi une séquence de la formule ASVDPTIDLLQA (Séq. #2). Une séquence agrandie de la formule TVTASVDPTIDLLQAD (Séq. #3) s'est révélée particulièrement intéressante, de même que des séquences intermédiaires, telles que VTASVDPTIDLLQAD (Séq. #4), TASVDPTIDLLQAD (Séq. #5), et TASVDPTIDLLQA (Séq. #6), car elles constituent des sites de fixation d'anticorps dirigés contre les protéines dénaturées.

LandOfFree

Say what you really think

Search LandOfFree.com for Canadian inventors and patents. Rate them and share your experience with other people.

Rating

Peptides responsive to antibodies against a consensus... does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Peptides responsive to antibodies against a consensus..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Peptides responsive to antibodies against a consensus... will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFCA-PAI-O-1606616

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.