Use of a lestr/fusin/cxcr4 receptor ligand chemokine (sdf-1)...

Details Use of a lestr/fusin/cxcr4 receptor ligand chemokine (sdf-1)... Use of a lestr/fusin/cxcr4 receptor ligand chemokine (sdf-1)...

C - Chemistry, Metallurgy

12

N

C12N 15/19 (2006.01) A61K 31/70 (2006.01) A61K 35/12 (2006.01) A61K 38/19 (2006.01) A61K 48/00 (2006.01) C07K 14/52 (2006.01) C07K 16/24 (2006.01) C07K 16/28 (2006.01) C07K 19/00 (2006.01) C12N 15/62 (2006.01) G01N 33/53 (2006.01) A61K 38/00 (2006.01)

Patent

CA 2259948

An SDF-1 chemokine or a molecule derived therform for treating and/or preventing HIV retroviral infection is disclosed. Said chemokine consists of, is contained in or contains the following aminoacid sequence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN.

L'invention a pour objet une chemokine SDF-1 ou molecule dérivée de SDF-1 pour la prévention et/ou le traitement d'une infection par un rétrovirus VIH, caractérisée en ce qu'elle répond à la séquence d'acides aminés ci-dessous ou en ce qu'elle est contenue dans cette séquence, ou en ce qu'elle contient cette séquence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN.

Affiliated with

Also associated with

Rating

Use of a lestr/fusin/cxcr4 receptor ligand chemokine (sdf-1)... does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Use of a lestr/fusin/cxcr4 receptor ligand chemokine (sdf-1)..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Use of a lestr/fusin/cxcr4 receptor ligand chemokine (sdf-1)... will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFCA-PAI-O-1813814