C - Chemistry – Metallurgy – 12 – N
Patent
C - Chemistry, Metallurgy
12
N
C12N 15/18 (2006.01) A01K 67/027 (2006.01) C07K 14/495 (2006.01) C07K 14/71 (2006.01) C12N 15/12 (2006.01) C12N 15/85 (2006.01) C12Q 1/68 (2006.01) A61K 38/00 (2006.01)
Patent
CA 2291754
The current invention concerns SMAD-interacting protein(s) obtainable by a two- hybrid screening assay whereby Smad1 C-domain fused to GAL4 DNA-binding domain as bait and a cDNA library from mouse embryo as prey are used. Some characteristics of a specific SMAD interacting protein so-called SIP1 are the follwing: a) it fails to interact with full size XSmad1 in yeast; b) it is a member of the family of zinc finger/homeodomain proteins including .delta.-crystallin enhancer binding protein and/or Drosophila zfh-1; c) SIP1czf binds to E2 box sites, d) SIP1cxf binds to the Brachyury protein binding site; e) it interferes with Brachyury-mediated transcription activation in cells and f) it interacts with C-domain of Smad 1,2 and 5. The minimal length of the amino acid sequence necessary for binding with Smad appears to be a 51 aa domain encompassing aa 166-216 of SEQ ID NO 2 having the amino acid sequence as depicted in the one letter code: QHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKTEDISKLK.
La présente invention concerne des protéines à interaction avec SMAD pouvant être obtenues par un dosage de criblage double hybride dans lequel on utilise un domaine C de Smad1 réuni par fusion avec un domaine de liaison d'ADN GAL4 comme appât et une banque d'ADN complémentaire provenant d'un embryon de souris comme proie. Une protéine à interaction avec SMAD spécifique dénommée SIP1 présente les caractéristiques suivantes: a) elle n'entre pas en interaction avec une XSmad1 entière dans la levure b) elle appartient à la famille de protéines de doigts à zinc/à homéodomaines comprenant la protéine de liaison d'activateur delta -cristallin et/ou Drosophile zfh-1 c) SIP1czf se lie à des sites de séquence E2 d) SIP1czf se lie au site de liaison de la protéine Brachyury e) elle perturbe l'activation de la transcription induite par Brachyury dans des cellules et f) elle entre en interaction avec le domaine C de Smad 1,2 et 5. La longueur minimale de la séquence d'acides aminés nécessaire à la liaison avec Smad semble être un domaine 51aa englobant aa 166-216 de la SEQ ID NO 2 dont la séquence d'acides aminés apparaît comme décrit dans le code à une lettre: QHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKTEDISKLK.
Huylebroeck Danny
Remacle Jacques
Verschueren Kristin
Fetherstonhaugh & Co.
Vlaams Interuniversitair Instituut Voor Biotechnologie
LandOfFree
Smad-interacting polypeptides and their use does not yet have a rating. At this time, there are no reviews or comments for this patent.
If you have personal experience with Smad-interacting polypeptides and their use, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Smad-interacting polypeptides and their use will most certainly appreciate the feedback.
Profile ID: LFCA-PAI-O-1595973